PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000376.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family bZIP
Protein Properties Length: 216aa    MW: 25011.7 Da    PI: 10.6486
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000376.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10105161561
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                              ++ rr+++NRe+ArrsR RK++ +e+L++ v  L   N++L ++    + ++  ++s
  Itr_sc000376.1_g00008.1 105 RKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRLGNRELLNRFRFVSHHCHLVQS 161
                              5789***********************************999887777777765555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.3E-13101165IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-8101149No hitNo description
PROSITE profilePS502179.921103148IPR004827Basic-leucine zipper domain
PfamPF001708.3E-8105156IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.64E-11105156No hitNo description
CDDcd147022.61E-18106157No hitNo description
PROSITE patternPS000360108123IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MSFDPFFSNP LPPFEGGFTS WDIPESAFDD FPAQLDQQPV LSPLQEPVIS NSGSESDNSN  60
SNQNPVNSNS GSDEPSRKRT RPVSESGMDE PDPNQAVSLP AVDERKRRRM ISNRESARRS  120
RMRKQKHLEN LRNQVNRLRL GNRELLNRFR FVSHHCHLVQ SDNERLRAES SLLRQRLWDI  180
RQVLLVRQLQ HQLSTSAWGF NNNNNVEQRL QSLITR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104108RKRRR
2104125RKRRRMISNRESARRSRMRKQK
3117124RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560923.16e-60PREDICTED: light-inducible protein CPRF2-like
TrEMBLA0A068U4U64e-62A0A068U4U6_COFCA; Uncharacterized protein
STRINGVIT_00s0541g00020.t018e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37730.14e-17basic leucine-zipper 7